NDUFB5 polyclonal antibody (A01) View larger

NDUFB5 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB5 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NDUFB5 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004711-A01
Product name: NDUFB5 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NDUFB5.
Gene id: 4711
Gene name: NDUFB5
Gene alias: CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa
Genbank accession: NM_002492
Immunogen: NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN
Protein accession: NP_002483
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004711-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NDUFB5 polyclonal antibody (A01) now

Add to cart