NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004709-D01P
Product name: NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NDUFB3 protein.
Gene id: 4709
Gene name: NDUFB3
Gene alias: B12
Gene description: NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 3, 12kDa
Genbank accession: NM_002491.1
Immunogen: NDUFB3 (NP_002482.1, 1 a.a. ~ 98 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAHEHGHEHGHHKMELPDYRQWKIEGTPLETIQKKLAAKGLRDPWGRNEAWRYMGGFAKSVSFSDVFFKGFKWGFAAFVVAVGAEYYLESLNKDKKHH
Protein accession: NP_002482.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004709-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NDUFB3 expression in transfected 293T cell line (H00004709-T02) by NDUFB3 MaxPab polyclonal antibody.

Lane 1: NDUFB3 transfected lysate(11.40 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFB3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart