Brand: | Abnova |
Reference: | H00004706-M06 |
Product name: | NDUFAB1 monoclonal antibody (M06), clone 2D10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant NDUFAB1. |
Clone: | 2D10 |
Isotype: | IgG2b Kappa |
Gene id: | 4706 |
Gene name: | NDUFAB1 |
Gene alias: | ACP|FASN2A|MGC65095|SDAP |
Gene description: | NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa |
Genbank accession: | BC058920 |
Immunogen: | NDUFAB1 (AAH58920, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIADKKDVYE |
Protein accession: | AAH58920 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (42.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NDUFAB1 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |