NDUFAB1 monoclonal antibody (M06), clone 2D10 View larger

NDUFAB1 monoclonal antibody (M06), clone 2D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFAB1 monoclonal antibody (M06), clone 2D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NDUFAB1 monoclonal antibody (M06), clone 2D10

Brand: Abnova
Reference: H00004706-M06
Product name: NDUFAB1 monoclonal antibody (M06), clone 2D10
Product description: Mouse monoclonal antibody raised against a full length recombinant NDUFAB1.
Clone: 2D10
Isotype: IgG2b Kappa
Gene id: 4706
Gene name: NDUFAB1
Gene alias: ACP|FASN2A|MGC65095|SDAP
Gene description: NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Genbank accession: BC058920
Immunogen: NDUFAB1 (AAH58920, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPYIDAEKLMCPQEIVDYIADKKDVYE
Protein accession: AAH58920
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004706-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.9 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004706-M06-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NDUFAB1 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFAB1 monoclonal antibody (M06), clone 2D10 now

Add to cart