| Brand:  | Abnova | 
| Reference:  | H00004704-M01 | 
| Product name:  | NDUFA9 monoclonal antibody (M01), clone 3D7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant NDUFA9. | 
| Clone:  | 3D7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 4704 | 
| Gene name:  | NDUFA9 | 
| Gene alias:  | MGC111043|NDUFS2L|SDR22E1 | 
| Gene description:  | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa | 
| Genbank accession:  | NM_005002 | 
| Immunogen:  | NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI | 
| Protein accession:  | NP_004993 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (33.99 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse,Rat | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to NDUFA9 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.8 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |