Brand: | Abnova |
Reference: | H00004704-A01 |
Product name: | NDUFA9 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NDUFA9. |
Gene id: | 4704 |
Gene name: | NDUFA9 |
Gene alias: | MGC111043|NDUFS2L|SDR22E1 |
Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa |
Genbank accession: | NM_005002 |
Immunogen: | NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI |
Protein accession: | NP_004993 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.36 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |