Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 549,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 549,00 €
Data sheet of NDUFA9 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about NDUFA9 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004704-A01 |
| Product name: | NDUFA9 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NDUFA9. |
| Gene id: | 4704 |
| Gene name: | NDUFA9 |
| Gene alias: | MGC111043|NDUFS2L|SDR22E1 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 9, 39kDa |
| Genbank accession: | NM_005002 |
| Immunogen: | NDUFA9 (NP_004993, 303 a.a. ~ 377 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RVFEISPFEPWITRDKVERMHITDMKLPHLPGLEDLGIQATPLELKAIEVLRRHRTYRWLSAEIEDVKPAKTVNI |
| Protein accession: | NP_004993 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |