Brand: | Abnova |
Reference: | H00004702-M05 |
Product name: | NDUFA8 monoclonal antibody (M05), clone 2E10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFA8. |
Clone: | 2E10 |
Isotype: | IgG2a Kappa |
Gene id: | 4702 |
Gene name: | NDUFA8 |
Gene alias: | CI-19KD|CI-PGIV|MGC793|PGIV |
Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa |
Genbank accession: | NM_014222 |
Immunogen: | NDUFA8 (NP_055037.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR |
Protein accession: | NP_055037.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |