| Brand: | Abnova |
| Reference: | H00004702-M05 |
| Product name: | NDUFA8 monoclonal antibody (M05), clone 2E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFA8. |
| Clone: | 2E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4702 |
| Gene name: | NDUFA8 |
| Gene alias: | CI-19KD|CI-PGIV|MGC793|PGIV |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa |
| Genbank accession: | NM_014222 |
| Immunogen: | NDUFA8 (NP_055037.1, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFR |
| Protein accession: | NP_055037.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to NDUFA8 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |