Cart 287 Product Products 95 177,28 € (empty)
-
-
-
-
-
-
-
-
-
-
-
1 x HSF1...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Histone H4...259,07 € -
-
-
-
-
-
-
-
-
-
-
1 x c-Myb...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x JAM-B...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x LRAT...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x ATPAF2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x CPE...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x V1RL3...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MRP-S32...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AP-1...259,07 € -
-
-
1 x ETO-2...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x MAO-A...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x AP-2γ...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
95 177,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 287 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 95 177,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 95 177,28 €
Data sheet of NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about NDUFA8 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00004702-B01P |
| Product name: | NDUFA8 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NDUFA8 protein. |
| Gene id: | 4702 |
| Gene name: | NDUFA8 |
| Gene alias: | CI-19KD|CI-PGIV|MGC793|PGIV |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa |
| Genbank accession: | NM_014222.2 |
| Immunogen: | NDUFA8 (NP_055037.1, 1 a.a. ~ 172 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK |
| Protein accession: | NP_055037.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NDUFA8 expression in transfected 293T cell line (H00004702-T01) by NDUFA8 MaxPab polyclonal antibody. Lane 1: NDUFA8 transfected lysate(18.92 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |