NDUFA8 MaxPab mouse polyclonal antibody (B01) View larger

NDUFA8 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFA8 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NDUFA8 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004702-B01
Product name: NDUFA8 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NDUFA8 protein.
Gene id: 4702
Gene name: NDUFA8
Gene alias: CI-19KD|CI-PGIV|MGC793|PGIV
Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 8, 19kDa
Genbank accession: NM_014222.2
Immunogen: NDUFA8 (NP_055037.1, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK
Protein accession: NP_055037.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004702-B01-13-15-1.jpg
Application image note: Western Blot analysis of NDUFA8 expression in transfected 293T cell line (H00004702-T01) by NDUFA8 MaxPab polyclonal antibody.

Lane 1: NDUFA8 transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFA8 MaxPab mouse polyclonal antibody (B01) now

Add to cart