Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00004698-D01P |
Product name: | NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NDUFA5 protein. |
Gene id: | 4698 |
Gene name: | NDUFA5 |
Gene alias: | B13|CI-13KD-B|DKFZp781K1356|FLJ12147|NUFM|UQOR13 |
Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa |
Genbank accession: | NM_005000.2 |
Immunogen: | NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI |
Protein accession: | NP_004991.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NDUFA5 expression in transfected 293T cell line (H00004698-T02) by NDUFA5 MaxPab polyclonal antibody. Lane 1: NDUFA5 transfected lysate(13.50 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |