Cart 24 Product Products 8 504,17 € (empty)
No products
To be determined Shipping
8 504,17 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 24 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 8 504,17 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 8 504,17 €
Data sheet of NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00004698-D01P |
| Product name: | NDUFA5 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NDUFA5 protein. |
| Gene id: | 4698 |
| Gene name: | NDUFA5 |
| Gene alias: | B13|CI-13KD-B|DKFZp781K1356|FLJ12147|NUFM|UQOR13 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa |
| Genbank accession: | NM_005000.2 |
| Immunogen: | NDUFA5 (NP_004991.1, 1 a.a. ~ 116 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI |
| Protein accession: | NP_004991.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NDUFA5 expression in transfected 293T cell line (H00004698-T02) by NDUFA5 MaxPab polyclonal antibody. Lane 1: NDUFA5 transfected lysate(13.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |