View larger

NDUFA3 (Human) Recombinant Protein (P01)

Reference:

Condition: New product

Data sheet of NDUFA3 (Human) Recombinant Protein (P01)

Brand:	Abnova
Reference:	H00004696-P01
Product name:	NDUFA3 (Human) Recombinant Protein (P01)
Product description:	Human NDUFA3 full-length ORF ( NP_004533.1, 1 a.a. - 84 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id:	4696
Gene name:	NDUFA3
Gene alias:	B9
Gene description:	NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
Genbank accession:	NM_004542.1
Immunogen sequence/protein sequence:	MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Protein accession:	NP_004533.1
Preparation method:	in vitro wheat germ expression system
Storage buffer:	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction:	Store at -80Â°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture:
Note:	Best use within three months from the date of receipt of this protein.
Tag:	GST
Product type:	Proteins
Host species:	Wheat Germ (in vitro)
Antigen species / target species:	Human
Applications:	AP,Array,ELISA,WB-Re
Shipping condition:	Dry Ice