| Brand: | Abnova |
| Reference: | H00004694-M01 |
| Product name: | NDUFA1 monoclonal antibody (M01), clone 3B9-1A1 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NDUFA1. |
| Clone: | 3B9-1A1 |
| Isotype: | IgG1 kappa |
| Gene id: | 4694 |
| Gene name: | NDUFA1 |
| Gene alias: | CI-MWFE|MWFE|ZNF183 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa |
| Genbank accession: | BC000266 |
| Immunogen: | NDUFA1 (AAH00266, 24 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
| Protein accession: | AAH00266 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (30.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged NDUFA1 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |