Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 294,94 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 294,94 €
Data sheet of NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00004694-D01P |
| Product name: | NDUFA1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NDUFA1 protein. |
| Gene id: | 4694 |
| Gene name: | NDUFA1 |
| Gene alias: | CI-MWFE|MWFE|ZNF183 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa |
| Genbank accession: | NM_004541.2 |
| Immunogen: | NDUFA1 (AAH00266.1, 1 a.a. ~ 70 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
| Protein accession: | AAH00266.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NDUFA1 expression in transfected 293T cell line (H00004694-T02) by NDUFA1 MaxPab polyclonal antibody. Lane 1: NDUFA1 transfected lysate(8.10 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |