| Brand: | Abnova |
| Reference: | H00004692-M15 |
| Product name: | NDN monoclonal antibody (M15), clone 2G8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant NDN. |
| Clone: | 2G8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4692 |
| Gene name: | NDN |
| Gene alias: | HsT16328|PWCR |
| Gene description: | necdin homolog (mouse) |
| Genbank accession: | NM_002487 |
| Immunogen: | NDN (NP_002478, 102 a.a. ~ 183 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSN |
| Protein accession: | NP_002478 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of NDN transfected lysate using anti-NDN monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NDN MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |