| Brand: | Abnova |
| Reference: | H00004686-M04 |
| Product name: | NCBP1 monoclonal antibody (M04), clone 1E9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NCBP1. |
| Clone: | 1E9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4686 |
| Gene name: | NCBP1 |
| Gene alias: | CBP80|MGC2087|NCBP |
| Gene description: | nuclear cap binding protein subunit 1, 80kDa |
| Genbank accession: | NM_002486 |
| Immunogen: | NCBP1 (NP_002477, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN |
| Protein accession: | NP_002477 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged NCBP1 is approximately 30ng/ml as a capture antibody. |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |