NCAM2 polyclonal antibody (A01) View larger

NCAM2 polyclonal antibody (A01)

New product

286,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCAM2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NCAM2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004685-A01
Product name: NCAM2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NCAM2.
Gene id: 4685
Gene name: NCAM2
Gene alias: MGC51008|NCAM21
Gene description: neural cell adhesion molecule 2
Genbank accession: NM_004540
Immunogen: NCAM2 (NP_004531, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
Protein accession: NP_004531
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004685-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - NCAM2 purified MaxPab rabbit polyclonal antibody (D01P)
- NCBP1 MaxPab mouse polyclonal antibody (B01)
- NCBP1 purified MaxPab mouse polyclonal antibody (B01P)
- NCF2 purified MaxPab mouse polyclonal antibody (B01P)
- NCF4 polyclonal antibody (A01)
Shipping condition: Dry Ice
Publications: Novel post-digest isotope coded protein labeling method for phospho- and glycoproteome analysis.Fleron M, Greffe Y, Musmeci D, Massart AC, Hennequiere V, Mazzucchelli G, Waltregny D, De Pauw-Gillet MC, Castronovo V, De Pauw E, Turtoi A.
J Proteomics. 2010 Jul 1. [Epub ahead of print]

Buy NCAM2 polyclonal antibody (A01) now

Add to cart