| Brand: | Abnova |
| Reference: | H00004685-A01 |
| Product name: | NCAM2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant NCAM2. |
| Gene id: | 4685 |
| Gene name: | NCAM2 |
| Gene alias: | MGC51008|NCAM21 |
| Gene description: | neural cell adhesion molecule 2 |
| Genbank accession: | NM_004540 |
| Immunogen: | NCAM2 (NP_004531, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL |
| Protein accession: | NP_004531 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Novel post-digest isotope coded protein labeling method for phospho- and glycoproteome analysis.Fleron M, Greffe Y, Musmeci D, Massart AC, Hennequiere V, Mazzucchelli G, Waltregny D, De Pauw-Gillet MC, Castronovo V, De Pauw E, Turtoi A. J Proteomics. 2010 Jul 1. [Epub ahead of print] |