Login to display prices
Login to display prices
NCAM2 polyclonal antibody (A01) View larger

NCAM2 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCAM2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NCAM2 polyclonal antibody (A01)

Reference: H00004685-A01
Product name: NCAM2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NCAM2.
Gene id: 4685
Gene name: NCAM2
Gene alias: MGC51008|NCAM21
Gene description: neural cell adhesion molecule 2
Genbank accession: NM_004540
Immunogen: NCAM2 (NP_004531, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SIHGQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTMGYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTL
Protein accession: NP_004531
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: