Login to display prices
Login to display prices
NCAM1 monoclonal antibody (M01), clone 3G12 View larger

NCAM1 monoclonal antibody (M01), clone 3G12

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCAM1 monoclonal antibody (M01), clone 3G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NCAM1 monoclonal antibody (M01), clone 3G12

Reference: H00004684-M01
Product name: NCAM1 monoclonal antibody (M01), clone 3G12
Product description: Mouse monoclonal antibody raised against a partial recombinant NCAM1.
Clone: 3G12
Isotype: IgG1 Kappa
Gene id: 4684
Gene name: NCAM1
Gene alias: CD56|MSK39|NCAM
Gene description: neural cell adhesion molecule 1
Genbank accession: BC047244
Immunogen: NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Protein accession: AAH47244
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: