NCAM1 monoclonal antibody (M01), clone 3G12 View larger

NCAM1 monoclonal antibody (M01), clone 3G12

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCAM1 monoclonal antibody (M01), clone 3G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about NCAM1 monoclonal antibody (M01), clone 3G12

Brand: Abnova
Reference: H00004684-M01
Product name: NCAM1 monoclonal antibody (M01), clone 3G12
Product description: Mouse monoclonal antibody raised against a partial recombinant NCAM1.
Clone: 3G12
Isotype: IgG1 Kappa
Gene id: 4684
Gene name: NCAM1
Gene alias: CD56|MSK39|NCAM
Gene description: neural cell adhesion molecule 1
Genbank accession: BC047244
Immunogen: NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP
Protein accession: AAH47244
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004684-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004684-M01-13-15-1.jpg
Application image note: Western Blot analysis of NCAM1 expression in transfected 293T cell line by NCAM1 monoclonal antibody (M01), clone 3G12.

Lane 1: NCAM1 transfected lysate(94.6 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Related products: - NCBP1 monoclonal antibody (M04), clone 1E9
- NCF4 monoclonal antibody (M01), clone 3C10
- NCK1 monoclonal antibody (M01), clone 1A1
- NDN monoclonal antibody (M02), clone 1B3
- NDN monoclonal antibody (M05), clone 3B9
Shipping condition: Dry Ice
Publications: Molecular characterization and expression analyses of ST8Sia II and IV in piglets during postnatal development: lack of correlation between transcription and posttranslational levels.Zhu X, Chen Y, Zhang N, Zheng Z, Zhao F, Liu N, Lv C, Troy FA 2nd, Wang B.
Glycoconj J. 2015 Oct 9.

Buy NCAM1 monoclonal antibody (M01), clone 3G12 now

Add to cart