Cart 7 Product Products 1 791,28 € (empty)
-
-
-
-
1 x Rabbit Ig...137,00 € -
-
-
No products
To be determined Shipping
1 791,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 7 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 791,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 791,28 €
Data sheet of NCAM1 monoclonal antibody (M01), clone 3G12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about NCAM1 monoclonal antibody (M01), clone 3G12
| Brand: | Abnova |
| Reference: | H00004684-M01 |
| Product name: | NCAM1 monoclonal antibody (M01), clone 3G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NCAM1. |
| Clone: | 3G12 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4684 |
| Gene name: | NCAM1 |
| Gene alias: | CD56|MSK39|NCAM |
| Gene description: | neural cell adhesion molecule 1 |
| Genbank accession: | BC047244 |
| Immunogen: | NCAM1 (AAH47244, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEIRLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIP |
| Protein accession: | AAH47244 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NCAM1 expression in transfected 293T cell line by NCAM1 monoclonal antibody (M01), clone 3G12. Lane 1: NCAM1 transfected lysate(94.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Molecular characterization and expression analyses of ST8Sia II and IV in piglets during postnatal development: lack of correlation between transcription and posttranslational levels.Zhu X, Chen Y, Zhang N, Zheng Z, Zhao F, Liu N, Lv C, Troy FA 2nd, Wang B. Glycoconj J. 2015 Oct 9. |