Login to display prices
Login to display prices
NBN monoclonal antibody (M02), clone 2C7 View larger

NBN monoclonal antibody (M02), clone 2C7

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBN monoclonal antibody (M02), clone 2C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NBN monoclonal antibody (M02), clone 2C7

Reference: H00004683-M02
Product name: NBN monoclonal antibody (M02), clone 2C7
Product description: Mouse monoclonal antibody raised against a partial recombinant NBN.
Clone: 2C7
Isotype: IgG2a Kappa
Gene id: 4683
Gene name: NBN
Gene alias: AT-V1|AT-V2|ATV|FLJ10155|MGC87362|NBS|NBS1|P95
Gene description: nibrin
Genbank accession: NM_002485
Immunogen: NBN (NP_002476, 645 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Protein accession: NP_002476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: