NBN monoclonal antibody (M02), clone 2C7 View larger

NBN monoclonal antibody (M02), clone 2C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBN monoclonal antibody (M02), clone 2C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NBN monoclonal antibody (M02), clone 2C7

Brand: Abnova
Reference: H00004683-M02
Product name: NBN monoclonal antibody (M02), clone 2C7
Product description: Mouse monoclonal antibody raised against a partial recombinant NBN.
Clone: 2C7
Isotype: IgG2a Kappa
Gene id: 4683
Gene name: NBN
Gene alias: AT-V1|AT-V2|ATV|FLJ10155|MGC87362|NBS|NBS1|P95
Gene description: nibrin
Genbank accession: NM_002485
Immunogen: NBN (NP_002476, 645 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Protein accession: NP_002476
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004683-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004683-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NBN is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - NCAM1 monoclonal antibody (M01), clone 3G12
- NCBP1 monoclonal antibody (M04), clone 1E9
- NCF4 monoclonal antibody (M01), clone 3C10
- NCK1 monoclonal antibody (M01), clone 1A1
- NDN monoclonal antibody (M02), clone 1B3
Shipping condition: Dry Ice

Buy NBN monoclonal antibody (M02), clone 2C7 now

Add to cart