NUBP1 (Human) Recombinant Protein (P01) View larger

NUBP1 (Human) Recombinant Protein (P01)

New product

374,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUBP1 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about NUBP1 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00004682-P01
Product name: NUBP1 (Human) Recombinant Protein (P01)
Product description: Human NUBP1 full-length ORF ( NP_002475.2, 1 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 4682
Gene name: NUBP1
Gene alias: MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene description: nucleotide binding protein 1 (MinD homolog, E. coli)
Genbank accession: NM_002484.2
Immunogen sequence/protein sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Protein accession: NP_002475.2
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00004682-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - NUBP1 (Human) Recombinant Protein (Q01)
- NBN (Human) Recombinant Protein (P01)
- NBN (Human) Recombinant Protein (Q01)
- NCAM1 (Human) Recombinant Protein
- NCAM1 (Human) Recombinant Protein (Q01)
Shipping condition: Dry Ice

Buy NUBP1 (Human) Recombinant Protein (P01) now

Add to cart