Login to display prices
Login to display prices
NUBP1 monoclonal antibody (M03), clone 2B11 View larger

NUBP1 monoclonal antibody (M03), clone 2B11

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUBP1 monoclonal antibody (M03), clone 2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NUBP1 monoclonal antibody (M03), clone 2B11

Reference: H00004682-M03
Product name: NUBP1 monoclonal antibody (M03), clone 2B11
Product description: Mouse monoclonal antibody raised against a partial recombinant NUBP1.
Clone: 2B11
Isotype: IgG2a Kappa
Gene id: 4682
Gene name: NUBP1
Gene alias: MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene description: nucleotide binding protein 1 (MinD homolog, Escherichia coli (E. coli))
Genbank accession: NM_002484
Immunogen: NUBP1 (NP_002475.1, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Protein accession: NP_002475.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: