NUBP1 monoclonal antibody (M03), clone 2B11 View larger

NUBP1 monoclonal antibody (M03), clone 2B11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUBP1 monoclonal antibody (M03), clone 2B11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NUBP1 monoclonal antibody (M03), clone 2B11

Brand: Abnova
Reference: H00004682-M03
Product name: NUBP1 monoclonal antibody (M03), clone 2B11
Product description: Mouse monoclonal antibody raised against a partial recombinant NUBP1.
Clone: 2B11
Isotype: IgG2a Kappa
Gene id: 4682
Gene name: NUBP1
Gene alias: MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene description: nucleotide binding protein 1 (MinD homolog, E. coli)
Genbank accession: NM_002484
Immunogen: NUBP1 (NP_002475.1, 222 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Protein accession: NP_002475.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004682-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004682-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NUBP1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Related products: - NBN monoclonal antibody (M01), clone 3E4
- NBN monoclonal antibody (M02), clone 2C7
- NCAM1 monoclonal antibody (M01), clone 3G12
- NCBP1 monoclonal antibody (M04), clone 1E9
- NCF4 monoclonal antibody (M01), clone 3C10
Shipping condition: Dry Ice

Buy NUBP1 monoclonal antibody (M03), clone 2B11 now

Add to cart