| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,WB-Tr |
| Brand: | Abnova |
| Reference: | H00004682-B01P |
| Product name: | NUBP1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human NUBP1 protein. |
| Gene id: | 4682 |
| Gene name: | NUBP1 |
| Gene alias: | MGC117406|MGC130052|MGC130053|NBP|NBP1 |
| Gene description: | nucleotide binding protein 1 (MinD homolog, E. coli) |
| Genbank accession: | NM_002484.1 |
| Immunogen: | NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
| Protein accession: | NP_002475.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of NUBP1 expression in transfected 293T cell line (H00004682-T01) by NUBP1 MaxPab polyclonal antibody. Lane 1: NUBP1 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway.Seki M, Takeda Y, Iwai K, Tanaka K J Biol Chem. 2013 Apr 12. |