NUBP1 purified MaxPab mouse polyclonal antibody (B01P) View larger

NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004682-B01P
Product name: NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NUBP1 protein.
Gene id: 4682
Gene name: NUBP1
Gene alias: MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene description: nucleotide binding protein 1 (MinD homolog, E. coli)
Genbank accession: NM_002484.1
Immunogen: NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Protein accession: NP_002475.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004682-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NUBP1 expression in transfected 293T cell line (H00004682-T01) by NUBP1 MaxPab polyclonal antibody.

Lane 1: NUBP1 transfected lysate(35.2 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Related products: - NCAM1 MaxPab mouse polyclonal antibody (B01)
- NCAM1 MaxPab rabbit polyclonal antibody (D01)
- NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)
- NCAM2 polyclonal antibody (A01)
- NCAM2 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice
Publications: IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway.Seki M, Takeda Y, Iwai K, Tanaka K
J Biol Chem. 2013 Apr 12.

Buy NUBP1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart