No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00004682-B01P |
Product name: | NUBP1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NUBP1 protein. |
Gene id: | 4682 |
Gene name: | NUBP1 |
Gene alias: | MGC117406|MGC130052|MGC130053|NBP|NBP1 |
Gene description: | nucleotide binding protein 1 (MinD homolog, E. coli) |
Genbank accession: | NM_002484.1 |
Immunogen: | NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
Protein accession: | NP_002475.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NUBP1 expression in transfected 293T cell line (H00004682-T01) by NUBP1 MaxPab polyclonal antibody. Lane 1: NUBP1 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway.Seki M, Takeda Y, Iwai K, Tanaka K J Biol Chem. 2013 Apr 12. |