Login to display prices
Login to display prices
NUBP1 purified MaxPab mouse polyclonal antibody (B01P) View larger

NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about NUBP1 purified MaxPab mouse polyclonal antibody (B01P)

Reference: H00004682-B01P
Product name: NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NUBP1 protein.
Gene id: 4682
Gene name: NUBP1
Gene alias: MGC117406|MGC130052|MGC130053|NBP|NBP1
Gene description: nucleotide binding protein 1 (MinD homolog, Escherichia coli (E. coli))
Genbank accession: NM_002484.1
Immunogen: NUBP1 (NP_002475.2, 1 a.a. ~ 320 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Protein accession: NP_002475.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: