NBL1 monoclonal antibody (M02), clone 1G5 View larger

NBL1 monoclonal antibody (M02), clone 1G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 monoclonal antibody (M02), clone 1G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NBL1 monoclonal antibody (M02), clone 1G5

Brand: Abnova
Reference: H00004681-M02
Product name: NBL1 monoclonal antibody (M02), clone 1G5
Product description: Mouse monoclonal antibody raised against a partial recombinant NBL1.
Clone: 1G5
Isotype: IgG2a Kappa
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Protein accession: NP_005371
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004681-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004681-M02-13-15-1.jpg
Application image note: Western Blot analysis of NBL1 expression in transfected 293T cell line by NBL1 monoclonal antibody (M02), clone 1G5.

Lane 1: NBL1 transfected lysate(19.3 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NBL1 monoclonal antibody (M02), clone 1G5 now

Add to cart