Login to display prices
Login to display prices
NBL1 monoclonal antibody (M02), clone 1G5 View larger

NBL1 monoclonal antibody (M02), clone 1G5

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 monoclonal antibody (M02), clone 1G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about NBL1 monoclonal antibody (M02), clone 1G5

Reference: H00004681-M02
Product name: NBL1 monoclonal antibody (M02), clone 1G5
Product description: Mouse monoclonal antibody raised against a partial recombinant NBL1.
Clone: 1G5
Isotype: IgG2a Kappa
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Protein accession: NP_005371
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: