NBL1 monoclonal antibody (M01), clone 2G4 View larger

NBL1 monoclonal antibody (M01), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 monoclonal antibody (M01), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NBL1 monoclonal antibody (M01), clone 2G4

Brand: Abnova
Reference: H00004681-M01
Product name: NBL1 monoclonal antibody (M01), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant NBL1.
Clone: 2G4
Isotype: IgG2a Kappa
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Protein accession: NP_005371
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004681-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004681-M01-1-4-1.jpg
Application image note: NBL1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of NBL1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Related products: - NBL1 monoclonal antibody (M02), clone 1G5
- NUBP1 monoclonal antibody (M03), clone 2B11
- NBN monoclonal antibody (M01), clone 3E4
- NBN monoclonal antibody (M02), clone 2C7
- NCAM1 monoclonal antibody (M01), clone 3G12
Shipping condition: Dry Ice

Buy NBL1 monoclonal antibody (M01), clone 2G4 now

Add to cart