Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 374,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 374,00 €
Data sheet of NBL1 monoclonal antibody (M01), clone 2G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about NBL1 monoclonal antibody (M01), clone 2G4
| Brand: | Abnova |
| Reference: | H00004681-M01 |
| Product name: | NBL1 monoclonal antibody (M01), clone 2G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NBL1. |
| Clone: | 2G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4681 |
| Gene name: | NBL1 |
| Gene alias: | D1S1733E|DAN|DAND1|MGC8972|NB|NO3 |
| Gene description: | neuroblastoma, suppression of tumorigenicity 1 |
| Genbank accession: | NM_005380 |
| Immunogen: | NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG |
| Protein accession: | NP_005371 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NBL1 monoclonal antibody (M01), clone 2G4 Western Blot analysis of NBL1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |