Login to display prices
Login to display prices
NBL1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

Reference: H00004681-D01P
Product name: NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Protein accession: NP_005371.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: