NBL1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about NBL1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004681-D01P
Product name: NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human NBL1 protein.
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371.1, 1 a.a. ~ 180 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED
Protein accession: NP_005371.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004681-D01P-13-15-1.jpg
Application image note: Western Blot analysis of NBL1 expression in transfected 293T cell line (H00004681-T01) by NBL1 MaxPab polyclonal antibody.

Lane 1: NBL1 transfected lysate(19.30 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Related products: - NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
- NCAM1 MaxPab mouse polyclonal antibody (B01)
- NCAM1 MaxPab rabbit polyclonal antibody (D01)
- NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)
- NCAM2 polyclonal antibody (A01)
Shipping condition: Dry Ice

Buy NBL1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart