NBL1 polyclonal antibody (A02) View larger

NBL1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NBL1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NBL1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00004681-A02
Product name: NBL1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant NBL1.
Gene id: 4681
Gene name: NBL1
Gene alias: D1S1733E|DAN|DAND1|MGC8972|NB|NO3
Gene description: neuroblastoma, suppression of tumorigenicity 1
Genbank accession: NM_005380
Immunogen: NBL1 (NP_005371, 21 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: INKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEG
Protein accession: NP_005371
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004681-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
- NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
- NCAM1 MaxPab mouse polyclonal antibody (B01)
- NCAM1 MaxPab rabbit polyclonal antibody (D01)
- NCAM1 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy NBL1 polyclonal antibody (A02) now

Add to cart