Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00004681-A01 |
Product name: | NBL1 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant NBL1. |
Gene id: | 4681 |
Gene name: | NBL1 |
Gene alias: | D1S1733E|DAN|DAND1|MGC8972|NB|NO3 |
Gene description: | neuroblastoma, suppression of tumorigenicity 1 |
Genbank accession: | BC012037 |
Immunogen: | NBL1 (AAH12037, 1 a.a. ~ 180 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MLRVLVGAVLPAMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKILHCSCQACGKEPSHEGLSVYVQGEDGPGSQPGTHPHPHPHPHPGGQTPEPEDPPGAPHTEEEGAED |
Protein accession: | AAH12037 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (45.91 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Related products: | - NBL1 polyclonal antibody (A02) - NBL1 purified MaxPab rabbit polyclonal antibody (D01P) - NUBP1 purified MaxPab mouse polyclonal antibody (B01P) - NCAM1 MaxPab mouse polyclonal antibody (B01) - NCAM1 MaxPab rabbit polyclonal antibody (D01) |
Shipping condition: | Dry Ice |