Login to display prices
Login to display prices
CEACAM6 (Human) Recombinant Protein (P01) View larger

CEACAM6 (Human) Recombinant Protein (P01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEACAM6 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Origin speciesHuman
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about CEACAM6 (Human) Recombinant Protein (P01)

Reference: H00004680-P01
Product name: CEACAM6 (Human) Recombinant Protein (P01)
Product description: Human CEACAM6 full-length ORF ( AAH05008.1, 1 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 4680
Gene name: CEACAM6
Gene alias: CD66c|CEAL|NCA
Gene description: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
Genbank accession: BC005008.1
Immunogen sequence/protein sequence: MGPPSAPPCRLHVPWKEVLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSGSAPVLSAVATVGITIGVLARVALI
Protein accession: AAH05008.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Shipping condition: Dry Ice

30 other products in the same category: