CEACAM6 monoclonal antibody (M02), clone 1G2 View larger

CEACAM6 monoclonal antibody (M02), clone 1G2

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEACAM6 monoclonal antibody (M02), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CEACAM6 monoclonal antibody (M02), clone 1G2

Brand: Abnova
Reference: H00004680-M02
Product name: CEACAM6 monoclonal antibody (M02), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant CEACAM6.
Clone: 1G2
Isotype: IgG1 Kappa
Gene id: 4680
Gene name: CEACAM6
Gene alias: CD66c|CEAL|NCA
Gene description: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
Genbank accession: NM_002483
Immunogen: CEACAM6 (NP_002474.3, 156 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
Protein accession: NP_002474.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004680-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004680-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CEACAM6 is 0.1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Related products: - NBL1 monoclonal antibody (M01), clone 2G4
- NBL1 monoclonal antibody (M02), clone 1G5
- NUBP1 monoclonal antibody (M03), clone 2B11
- NBN monoclonal antibody (M01), clone 3E4
- NBN monoclonal antibody (M02), clone 2C7
Shipping condition: Dry Ice

Buy CEACAM6 monoclonal antibody (M02), clone 1G2 now

Add to cart