Login to display prices
Login to display prices
CEACAM6 monoclonal antibody (M02), clone 1G2 View larger

CEACAM6 monoclonal antibody (M02), clone 1G2

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CEACAM6 monoclonal antibody (M02), clone 1G2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about CEACAM6 monoclonal antibody (M02), clone 1G2

Reference: H00004680-M02
Product name: CEACAM6 monoclonal antibody (M02), clone 1G2
Product description: Mouse monoclonal antibody raised against a partial recombinant CEACAM6.
Clone: 1G2
Isotype: IgG1 Kappa
Gene id: 4680
Gene name: CEACAM6
Gene alias: CD66c|CEAL|NCA
Gene description: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
Genbank accession: NM_002483
Immunogen: CEACAM6 (NP_002474.3, 156 a.a. ~ 265 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNP
Protein accession: NP_002474.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: