NARS monoclonal antibody (M02), clone 1D4 View larger

NARS monoclonal antibody (M02), clone 1D4

New product

395,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS monoclonal antibody (M02), clone 1D4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NARS monoclonal antibody (M02), clone 1D4

Brand: Abnova
Reference: H00004677-M02
Product name: NARS monoclonal antibody (M02), clone 1D4
Product description: Mouse monoclonal antibody raised against a partial recombinant NARS.
Clone: 1D4
Isotype: IgG2a Kappa
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: NM_004539
Immunogen: NARS (NP_004530, 441 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCT
Protein accession: NP_004530
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004677-M02-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged NARS is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Related products: - CEACAM6 monoclonal antibody (M02), clone 1G2
- NBL1 monoclonal antibody (M01), clone 2G4
- NBL1 monoclonal antibody (M02), clone 1G5
- NUBP1 monoclonal antibody (M03), clone 2B11
- NBN monoclonal antibody (M01), clone 3E4
Shipping condition: Dry Ice

Buy NARS monoclonal antibody (M02), clone 1D4 now

Add to cart