Brand: | Abnova |
Reference: | H00004677-M02 |
Product name: | NARS monoclonal antibody (M02), clone 1D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NARS. |
Clone: | 1D4 |
Isotype: | IgG2a Kappa |
Gene id: | 4677 |
Gene name: | NARS |
Gene alias: | ASNRS|NARS1 |
Gene description: | asparaginyl-tRNA synthetase |
Genbank accession: | NM_004539 |
Immunogen: | NARS (NP_004530, 441 a.a. ~ 547 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCT |
Protein accession: | NP_004530 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NARS is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |