Login to display prices
Login to display prices
NARS monoclonal antibody (M01), clone 2D6 View larger

NARS monoclonal antibody (M01), clone 2D6

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS monoclonal antibody (M01), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NARS monoclonal antibody (M01), clone 2D6

Reference: H00004677-M01
Product name: NARS monoclonal antibody (M01), clone 2D6
Product description: Mouse monoclonal antibody raised against a full length recombinant NARS.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: BC001687
Immunogen: NARS (AAH01687, 1 a.a. ~ 548 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Protein accession: AAH01687
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: