NARS monoclonal antibody (M01), clone 2D6 View larger

NARS monoclonal antibody (M01), clone 2D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS monoclonal antibody (M01), clone 2D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NARS monoclonal antibody (M01), clone 2D6

Brand: Abnova
Reference: H00004677-M01
Product name: NARS monoclonal antibody (M01), clone 2D6
Product description: Mouse monoclonal antibody raised against a full length recombinant NARS.
Clone: 2D6
Isotype: IgG2a Kappa
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: BC001687
Immunogen: NARS (AAH01687, 1 a.a. ~ 548 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Protein accession: AAH01687
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004677-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (86.02 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004677-M01-1-9-1.jpg
Application image note: NARS monoclonal antibody (M01), clone 2D6 Western Blot analysis of NARS expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Related products: - NARS monoclonal antibody (M02), clone 1D4
- CEACAM6 monoclonal antibody (M02), clone 1G2
- NBL1 monoclonal antibody (M01), clone 2G4
- NBL1 monoclonal antibody (M02), clone 1G5
- NUBP1 monoclonal antibody (M03), clone 2B11
Shipping condition: Dry Ice

Buy NARS monoclonal antibody (M01), clone 2D6 now

Add to cart