NARS MaxPab rabbit polyclonal antibody (D01) View larger

NARS MaxPab rabbit polyclonal antibody (D01)

New product

384,00 €

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,IF,WB-Tr,IP

More info about NARS MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00004677-D01
Product name: NARS MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human NARS protein.
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: NM_004539.2
Immunogen: NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Protein accession: NP_004530.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004677-D01-2-C4-1.jpg
Application image note: NARS MaxPab rabbit polyclonal antibody. Western Blot analysis of NARS expression in mouse spleen.
Applications: WB-Ce,WB-Ti,IF,WB-Tr,IP
Related products: - NARS purified MaxPab rabbit polyclonal antibody (D01P)
- NBL1 polyclonal antibody (A01)
- NBL1 polyclonal antibody (A02)
- NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
- NUBP1 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy NARS MaxPab rabbit polyclonal antibody (D01) now

Add to cart