Login to display prices
Login to display prices
NARS purified MaxPab mouse polyclonal antibody (B01P) View larger

NARS purified MaxPab mouse polyclonal antibody (B01P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about NARS purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004677-B01P
Product name: NARS purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NARS protein.
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: NM_004539.2
Immunogen: NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Protein accession: NP_004530.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004677-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NARS expression in transfected 293T cell line (H00004677-T02) by NARS MaxPab polyclonal antibody.

Lane 1: NARS transfected lysate(60.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Related products: - NARS MaxPab rabbit polyclonal antibody (D01)
- NARS purified MaxPab rabbit polyclonal antibody (D01P)
- NBL1 polyclonal antibody (A01)
- NBL1 polyclonal antibody (A02)
- NBL1 purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice