NARS MaxPab mouse polyclonal antibody (B01) View larger

NARS MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about NARS MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004677-B01
Product name: NARS MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NARS protein.
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: NM_004539.2
Immunogen: NARS (NP_004530.1, 1 a.a. ~ 548 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMWHREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQGKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGLAPAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEGGATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDLLNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIPEAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP
Protein accession: NP_004530.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004677-B01-13-15-1.jpg
Application image note: Western Blot analysis of NARS expression in transfected 293T cell line (H00004677-T01) by NARS MaxPab polyclonal antibody.

Lane 1: NARS transfected lysate(60.28 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NARS MaxPab mouse polyclonal antibody (B01) now

Add to cart