Login to display prices
Login to display prices
NARS polyclonal antibody (A01) View larger

NARS polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NARS polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NARS polyclonal antibody (A01)

Reference: H00004677-A01
Product name: NARS polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NARS.
Gene id: 4677
Gene name: NARS
Gene alias: ASNRS|NARS1
Gene description: asparaginyl-tRNA synthetase
Genbank accession: NM_004539
Immunogen: NARS (NP_004530, 441 a.a. ~ 547 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYKREGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCT
Protein accession: NP_004530
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: