NAP1L4 polyclonal antibody (A01) View larger

NAP1L4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP1L4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NAP1L4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004676-A01
Product name: NAP1L4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NAP1L4.
Gene id: 4676
Gene name: NAP1L4
Gene alias: MGC4565|NAP2|NAP2L|hNAP2
Gene description: nucleosome assembly protein 1-like 4
Genbank accession: NM_005969
Immunogen: NAP1L4 (NP_005960, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MADHSFSDGVPSDSVEAAKNASNTEKLTDQVMQNPRVLAALQERLDNVPHTPSSYIETLPKAVKRRINALKQLQVRCAHIEA
Protein accession: NP_005960
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004676-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Related products: - NARS polyclonal antibody (A01)
- NARS MaxPab mouse polyclonal antibody (B01)
- NARS purified MaxPab mouse polyclonal antibody (B01P)
- NARS MaxPab rabbit polyclonal antibody (D01)
- NARS purified MaxPab rabbit polyclonal antibody (D01P)
Shipping condition: Dry Ice

Buy NAP1L4 polyclonal antibody (A01) now

Add to cart