NAP1L1 monoclonal antibody (M01), clone 2A9 View larger

NAP1L1 monoclonal antibody (M01), clone 2A9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP1L1 monoclonal antibody (M01), clone 2A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NAP1L1 monoclonal antibody (M01), clone 2A9

Brand: Abnova
Reference: H00004673-M01
Product name: NAP1L1 monoclonal antibody (M01), clone 2A9
Product description: Mouse monoclonal antibody raised against a partial recombinant NAP1L1.
Clone: 2A9
Isotype: IgG2a Kappa
Gene id: 4673
Gene name: NAP1L1
Gene alias: FLJ16112|MGC23410|MGC8688|NAP1|NAP1L|NRP
Gene description: nucleosome assembly protein 1-like 1
Genbank accession: NM_004537
Immunogen: NAP1L1 (NP_004528, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
Protein accession: NP_004528
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004673-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004673-M01-1-1-1.jpg
Application image note: NAP1L1 monoclonal antibody (M01), clone 2A9. Western Blot analysis of NAP1L1 expression in HeLa(Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Related products: - NARS monoclonal antibody (M01), clone 2D6
- NARS monoclonal antibody (M02), clone 1D4
- CEACAM6 monoclonal antibody (M02), clone 1G2
- NBL1 monoclonal antibody (M01), clone 2G4
- NBL1 monoclonal antibody (M02), clone 1G5
Shipping condition: Dry Ice

Buy NAP1L1 monoclonal antibody (M01), clone 2A9 now

Add to cart