Brand: | Abnova |
Reference: | H00004673-M01 |
Product name: | NAP1L1 monoclonal antibody (M01), clone 2A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NAP1L1. |
Clone: | 2A9 |
Isotype: | IgG2a Kappa |
Gene id: | 4673 |
Gene name: | NAP1L1 |
Gene alias: | FLJ16112|MGC23410|MGC8688|NAP1|NAP1L|NRP |
Gene description: | nucleosome assembly protein 1-like 1 |
Genbank accession: | NM_004537 |
Immunogen: | NAP1L1 (NP_004528, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY |
Protein accession: | NP_004528 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NAP1L1 monoclonal antibody (M01), clone 2A9. Western Blot analysis of NAP1L1 expression in HeLa(Cat # L013V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |