Login to display prices
Login to display prices
NAP1L1 monoclonal antibody (M01), clone 2A9 View larger

NAP1L1 monoclonal antibody (M01), clone 2A9

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP1L1 monoclonal antibody (M01), clone 2A9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NAP1L1 monoclonal antibody (M01), clone 2A9

Reference: H00004673-M01
Product name: NAP1L1 monoclonal antibody (M01), clone 2A9
Product description: Mouse monoclonal antibody raised against a partial recombinant NAP1L1.
Clone: 2A9
Isotype: IgG2a Kappa
Gene id: 4673
Gene name: NAP1L1
Gene alias: FLJ16112|MGC23410|MGC8688|NAP1|NAP1L|NRP
Gene description: nucleosome assembly protein 1-like 1
Genbank accession: NM_004537
Immunogen: NAP1L1 (NP_004528, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLY
Protein accession: NP_004528
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: