Login to display prices
Login to display prices
NAP1L1 purified MaxPab mouse polyclonal antibody (B02P) View larger

NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)

Reference: H00004673-B02P
Product name: NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human NAP1L1 protein.
Gene id: 4673
Gene name: NAP1L1
Gene alias: FLJ16112|MGC23410|MGC8688|NAP1|NAP1L|NRP
Gene description: nucleosome assembly protein 1-like 1
Genbank accession: NM_004537
Immunogen: NAP1L1 (NP_004528.1, 1 a.a. ~ 391 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Protein accession: NP_004528.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Shipping condition: Dry Ice

30 other products in the same category: