NAP1L1 MaxPab mouse polyclonal antibody (B01) View larger

NAP1L1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAP1L1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NAP1L1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004673-B01
Product name: NAP1L1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human NAP1L1 protein.
Gene id: 4673
Gene name: NAP1L1
Gene alias: FLJ16112|MGC23410|MGC8688|NAP1|NAP1L|NRP
Gene description: nucleosome assembly protein 1-like 1
Genbank accession: BC002387
Immunogen: NAP1L1 (AAH02387, 1 a.a. ~ 391 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Protein accession: AAH02387
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004673-B01-13-15-1.jpg
Application image note: Western Blot analysis of NAP1L1 expression in transfected 293T cell line (H00004673-T01) by NAP1L1 MaxPab polyclonal antibody.

Lane 1: NAP1L1 transfected lysate(43.01 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Related products: - NAP1L1 purified MaxPab mouse polyclonal antibody (B02P)
- NAP1L2 purified MaxPab mouse polyclonal antibody (B01P)
- NAP1L2 MaxPab rabbit polyclonal antibody (D01)
- NAP1L2 purified MaxPab rabbit polyclonal antibody (D01P)
- NAP1L3 purified MaxPab mouse polyclonal antibody (B01P)
Shipping condition: Dry Ice

Buy NAP1L1 MaxPab mouse polyclonal antibody (B01) now

Add to cart