BIRC1 (Human) Recombinant Protein (Q01) View larger

BIRC1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BIRC1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about BIRC1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00004671-Q01
Product name: BIRC1 (Human) Recombinant Protein (Q01)
Product description: Human BIRC1 partial ORF ( NP_004527, 1294 a.a. - 1403 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 4671
Gene name: NAIP
Gene alias: BIRC1|FLJ18088|FLJ42520|FLJ58811|NLRB1|psiNAIP
Gene description: NLR family, apoptosis inhibitory protein
Genbank accession: NM_004536
Immunogen sequence/protein sequence: LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
Protein accession: NP_004527
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00004671-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Related products: - NAP1L1 (Human) Recombinant Protein (P01)
- NAP1L1 (Human) Recombinant Protein (Q01)
- NAP1L2 (Human) Recombinant Protein (P01)
- NAP1L2 (Human) Recombinant Protein (P02)
- NAP1L3 (Human) Recombinant Protein (P01)
Shipping condition: Dry Ice

Buy BIRC1 (Human) Recombinant Protein (Q01) now

Add to cart