Login to display prices
Login to display prices
BIRC1 polyclonal antibody (A01) View larger

BIRC1 polyclonal antibody (A01)

New product

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BIRC1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesMouse
ApplicationsELISA

More info about BIRC1 polyclonal antibody (A01)

Reference: H00004671-A01
Product name: BIRC1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant BIRC1.
Gene id: 4671
Gene name: NAIP
Gene alias: BIRC1|FLJ18088|FLJ42520|FLJ58811|NLRB1|psiNAIP
Gene description: NLR family, apoptosis inhibitory protein
Genbank accession: NM_004536
Immunogen: BIRC1 (NP_004527, 1294 a.a. ~ 1403 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LENLKLSINHKITEEGYRNFFQALDNMPNLQELDISRHFTECIKAQATTVKSLSQCVLRLPRLIRLNMLSWLLDADDIALLNVMKERHPQSKYLTILQKWILPFSPIIQK
Protein accession: NP_004527
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Shipping condition: Dry Ice

30 other products in the same category: