Cart 14 Product Products 4 890,28 € (empty)
No products
To be determined Shipping
4 890,28 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 14 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 890,28 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 890,28 €
Data sheet of HNRPM monoclonal antibody (M03), clone 3F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about HNRPM monoclonal antibody (M03), clone 3F7
| Brand: | Abnova |
| Reference: | H00004670-M03 |
| Product name: | HNRPM monoclonal antibody (M03), clone 3F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant HNRPM. |
| Clone: | 3F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4670 |
| Gene name: | HNRNPM |
| Gene alias: | DKFZp547H118|HNRNPM4|HNRPM|HNRPM4|HTGR1|NAGR1 |
| Gene description: | heterogeneous nuclear ribonucleoprotein M |
| Genbank accession: | NM_005968 |
| Immunogen: | HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR |
| Protein accession: | NP_005959 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Network Clustering Revealed the Systemic Alterations of Mitochondrial Protein Expression.Jeon J, Jeong JH, Baek JH, Koo HJ, Park WH, Yang JS, Yu MH, Kim S, Pak YK. PLoS Comput Biol. 2011 Jun;7(6):e1002093. Epub 2011 Jun 30. |