View larger

HNRPM monoclonal antibody (M01), clone 2B6

Reference:

Condition: New product

Data sheet of HNRPM monoclonal antibody (M01), clone 2B6

Brand:	Abnova
Reference:	H00004670-M01
Product name:	HNRPM monoclonal antibody (M01), clone 2B6
Product description:	Mouse monoclonal antibody raised against a partial recombinant HNRPM.
Clone:	2B6
Isotype:	IgG2b Kappa
Gene id:	4670
Gene name:	HNRNPM
Gene alias:	DKFZp547H118\|HNRNPM4\|HNRPM\|HNRPM4\|HTGR1\|NAGR1
Gene description:	heterogeneous nuclear ribonucleoprotein M
Genbank accession:	NM_005968
Immunogen:	HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
Protein accession:	NP_005959
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.3 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	HNRPM monoclonal antibody (M01), clone 2B6. Western Blot analysis of HNRPM expression in HepG2 ( Cat # L019V1 ).
Applications:	WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice