No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00004670-A01 |
| Product name: | HNRPM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HNRPM. |
| Gene id: | 4670 |
| Gene name: | HNRNPM |
| Gene alias: | DKFZp547H118|HNRNPM4|HNRPM|HNRPM4|HTGR1|NAGR1 |
| Gene description: | heterogeneous nuclear ribonucleoprotein M |
| Genbank accession: | NM_005968 |
| Immunogen: | HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR |
| Protein accession: | NP_005959 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Multiple and Specific mRNA Processing Targets for the Major Human hnRNP Proteins.Venables JP, Koh CS, Froehlich U, Lapointe E, Couture S, Inkel L, Bramard A, Paquet ER, Watier V, Durand M, Lucier JF, Gervais-Bird J, Tremblay K, Prinos P, Klinck R, Elela SA, Chabot B. Mol Cell Biol. 2008 Oct;28(19):6033-43. Epub 2008 Jul 21. |