Cart 154 Product Products 56 693,77 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Caspase-3...259,07 € -
1 x PAR4...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
56 693,77 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 154 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 56 693,77 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 56 693,77 €
Data sheet of HNRPM polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HNRPM polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004670-A01 |
| Product name: | HNRPM polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HNRPM. |
| Gene id: | 4670 |
| Gene name: | HNRNPM |
| Gene alias: | DKFZp547H118|HNRNPM4|HNRPM|HNRPM4|HTGR1|NAGR1 |
| Gene description: | heterogeneous nuclear ribonucleoprotein M |
| Genbank accession: | NM_005968 |
| Immunogen: | HNRPM (NP_005959, 17 a.a. ~ 112 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR |
| Protein accession: | NP_005959 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.67 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Multiple and Specific mRNA Processing Targets for the Major Human hnRNP Proteins.Venables JP, Koh CS, Froehlich U, Lapointe E, Couture S, Inkel L, Bramard A, Paquet ER, Watier V, Durand M, Lucier JF, Gervais-Bird J, Tremblay K, Prinos P, Klinck R, Elela SA, Chabot B. Mol Cell Biol. 2008 Oct;28(19):6033-43. Epub 2008 Jul 21. |