| Brand: | Abnova |
| Reference: | H00004669-M02 |
| Product name: | NAGLU monoclonal antibody (M02), clone 1B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NAGLU. |
| Clone: | 1B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4669 |
| Gene name: | NAGLU |
| Gene alias: | MPS-IIIB|MPS3B|NAG|UFHSD |
| Gene description: | N-acetylglucosaminidase, alpha- |
| Genbank accession: | NM_000263 |
| Immunogen: | NAGLU (NP_000254, 644 a.a. ~ 742 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YQLTLWGPEGNILDYANKQLAGLVANYYTPRWRLFLEALVDSVAQGIPFQQHQFDKNVFQLEQAFVLSKQRYPSQPRGDTVDLAKKIFLKYYPGWVAGS |
| Protein accession: | NP_000254 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged NAGLU is approximately 30ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |