NAB2 monoclonal antibody (M01), clone 4H6 View larger

NAB2 monoclonal antibody (M01), clone 4H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAB2 monoclonal antibody (M01), clone 4H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NAB2 monoclonal antibody (M01), clone 4H6

Brand: Abnova
Reference: H00004665-M01
Product name: NAB2 monoclonal antibody (M01), clone 4H6
Product description: Mouse monoclonal antibody raised against a partial recombinant NAB2.
Clone: 4H6
Isotype: IgG2a Kappa
Gene id: 4665
Gene name: NAB2
Gene alias: MADER|MGC75085
Gene description: NGFI-A binding protein 2 (EGR1 binding protein 2)
Genbank accession: NM_005967
Immunogen: NAB2 (NP_005958.1, 421 a.a. ~ 525 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ
Protein accession: NP_005958.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004665-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.29 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004665-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NAB2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NAB2 monoclonal antibody (M01), clone 4H6 now

Add to cart