Brand: | Abnova |
Reference: | H00004665-D01 |
Product name: | NAB2 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human NAB2 protein. |
Gene id: | 4665 |
Gene name: | NAB2 |
Gene alias: | MADER|MGC75085 |
Gene description: | NGFI-A binding protein 2 (EGR1 binding protein 2) |
Genbank accession: | BC007756.2 |
Immunogen: | NAB2 (AAH07756.1, 1 a.a. ~ 241 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG |
Protein accession: | AAH07756.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of NAB2 transfected lysate using anti-NAB2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with NAB2 purified MaxPab mouse polyclonal antibody (B01P) (H00004665-B01P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |