NAB2 purified MaxPab mouse polyclonal antibody (B01P) View larger

NAB2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NAB2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about NAB2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004665-B01P
Product name: NAB2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NAB2 protein.
Gene id: 4665
Gene name: NAB2
Gene alias: MADER|MGC75085
Gene description: NGFI-A binding protein 2 (EGR1 binding protein 2)
Genbank accession: BC007756.2
Immunogen: NAB2 (AAH07756.1, 1 a.a. ~ 241 a.a) full-length human protein.
Immunogen sequence/protein sequence: MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGRSTPESDVGAGGEEEAGSRWDWGWSRPTGARDGTPACLGRVWMDICRLWGHVQG
Protein accession: AAH07756.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004665-B01P-13-15-1.jpg
Application image note: Western Blot analysis of NAB2 expression in transfected 293T cell line (H00004665-T01) by NAB2 MaxPab polyclonal antibody.

Lane 1: NAB2 transfected lysate(26.51 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NAB2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart