Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00004660-D01P |
Product name: | PPP1R12B purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human PPP1R12B protein. |
Gene id: | 4660 |
Gene name: | PPP1R12B |
Gene alias: | MGC131980|MGC87886|MYPT2 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 12B |
Genbank accession: | ENST00000356764 |
Immunogen: | PPP1R12B (ENSP00000349206, 1 a.a. ~ 386 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF |
Protein accession: | ENSP00000349206 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PPP1R12B expression in transfected 293T cell line (H00004660-T03) by PPP1R12B MaxPab polyclonal antibody. Lane 1: PPP1R12B transfected lysate(43.30 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |