PPP1R12B MaxPab mouse polyclonal antibody (B01) View larger

PPP1R12B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R12B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PPP1R12B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004660-B01
Product name: PPP1R12B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PPP1R12B protein.
Gene id: 4660
Gene name: PPP1R12B
Gene alias: MGC131980|MGC87886|MYPT2
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 12B
Genbank accession: BC034430
Immunogen: PPP1R12B (AAH34430, 1 a.a. ~ 386 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF
Protein accession: AAH34430
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004660-B01-13-15-1.jpg
Application image note: Western Blot analysis of PPP1R12B expression in transfected 293T cell line (H00004660-T01) by PPP1R12B MaxPab polyclonal antibody.

Lane 1: PPP1R12B transfected lysate(42.57 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1R12B MaxPab mouse polyclonal antibody (B01) now

Add to cart