MYOG monoclonal antibody (M02), clone 3E3 View larger

MYOG monoclonal antibody (M02), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYOG monoclonal antibody (M02), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MYOG monoclonal antibody (M02), clone 3E3

Brand: Abnova
Reference: H00004656-M02
Product name: MYOG monoclonal antibody (M02), clone 3E3
Product description: Mouse monoclonal antibody raised against a full length recombinant MYOG.
Clone: 3E3
Isotype: IgG2b Kappa
Gene id: 4656
Gene name: MYOG
Gene alias: MYF4|MYOGENIN|bHLHc3
Gene description: myogenin (myogenic factor 4)
Genbank accession: BC053899
Immunogen: MYOG (AAH53899, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Protein accession: AAH53899
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004656-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MYOG is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MYOG monoclonal antibody (M02), clone 3E3 now

Add to cart