Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYO9A monoclonal antibody (M04), clone 4C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about MYO9A monoclonal antibody (M04), clone 4C11
| Brand: | Abnova |
| Reference: | H00004649-M04 |
| Product name: | MYO9A monoclonal antibody (M04), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYO9A. |
| Clone: | 4C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4649 |
| Gene name: | MYO9A |
| Gene alias: | FLJ11061|FLJ13244|MGC71859 |
| Gene description: | myosin IXA |
| Genbank accession: | NM_006901 |
| Immunogen: | MYO9A (NP_008832, 719 a.a. ~ 828 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GKRNIHRKTGHDDTAPCAILKSMDSFSFLQHPVHQRSLEILQRCKEEKYSITRKNPRTPLSDLQGMNALNEKNQHDTFDIAWNGRTGIRQSRLSSGTSLLDKDGIFANST |
| Protein accession: | NP_008832 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MYO9A is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |